Recombinant Human ACVR2B Protein(Fc tag)

Recombinant Human ACVR2B Protein(Fc tag) (HC0046AS)

Recombinant Human ActRIIB fused with Fc protein of human IgG1 was expressed in CHO cells.

Size Price Qty
100ug $984.50

PRODUCT INFORMATION

Cat.No.
HC0046AS
Synonyms
ACVR2B; ActR IIB; HTX4; ACTRIIB; ActR-IIB;
Species
Human
Accession
Source
CHO
Tag
Fc
Predicted N Terminal
Leu 25
Form
Lyophilized from sterile PBS, pH 7.4, 5 % trehalose and 5 % mannitol.
AA Sequence
SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTADDDDKEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin
< 1.0 EU per 1 microgram of protein (determined by LAL method).
Purity
> 90% by SDS - PAGE

Usage Guide

Storage
In lyophilized state for 1 year (4°C); After reconstitution under sterile conditions for 3 months (-70°C). Avoid repeated freeze/thaw cycles.
Reconstitution
Reconstitute in sterile distilled water to a concentration of 0.1-1.0 mg/mL.
Warning
For research use only!

BACKGROUND

Background
ACVR2A and ACVR2B are two activin type II receptors. ACVR2B is integral to the activin and myostatin signaling pathway. Ligands such as activin and myostatin bind to ACVR2A and ACVR2B. Myostatin, a negative regulator of skeletal muscle growth, is regarded as a potential therapeutic target and binds to ACVR2B effectively, and to a lesser extent, to ACVR2A. The structure of human ACVR2B kinase domain in complex with adenine establishes the conserved bilobal architecture consistent with all other catalytic kinase domains. Haplotype structure at the ACVR2B and follistatin loci may contribute to interindividual variation in skeletal muscle mass and strength. Defects in ACVR2B are a cause of left-right axis malformations.

INQUIRY

Back to School Promotion

  •   Email: info@profacgen.com
  •   Tel: 1-631-448-8149
  •   Fax: 1-631-938-8127
  •   45-1 Ramsey Road, Shirley, NY 11967, USA