Service Search Product Search Gene Search
HOME

Recombinant Human CAPN2 Protein(His tag) (HE0038CL)

Recombinant Human CAPN2 Protein (P17655) (Met 1-Leu 700) with a 6*His tag at the C-terminus was expressed in E. coli.
Size
Price
Qty
Order
Size:10ug
Price:$290.00
Qty:
Order: Order Online
Bulk Inquiry
PRODUCT INFORMATION
Cat.No.
HE0038CL
Synonyms
CAPN2; CANPL2; CANPml; mCANP; CANP 2; CANP2;
Species
Human
Accession
Source
E. coli
Tag
His
Form
Supplied as sterile 20mM PB, 150mM NaCl, 2mM DTT, 50% Glycerol, pH7.4.
AA Sequence
MAGIAAKLAKDREAAEGLGSHERAIKYLNQDYEALRNECLEAGTLFQDPSFPAIPSALGFKELGP YSSKTRGIEWKRPTEICADPQFIIGGATRTDICQGALGDCWLLAAIASLTLNEEILARVVPLNQS FQENYAGIFHFQFWQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSALLEKAYAKINGCYEAL SGGATTEGFEDFTGGIAEWYELKKPPPNLFKIIQKALQKGSLLGCSIDITSAADSEA
Endotoxin
< 1.0 EU per 1 microgram of protein (determined by LAL method).
Purity
> 95 % by SDS-PAGE.

Usage Guide
Storage
In lyophilized state for 1 year (4°C); After reconstitution under sterile conditions for 3 months (-70°C). Avoid repeated freeze/thaw cycles.
Warning
For research use only!

BACKGROUND
Background
Calcium-regulated non-lysosomal thiol-protease which catalyze limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction. Proteolytically cleaves MYOC at 'Arg-226' (PubMed:17650508).

Send Inquiry Now!
Name:
*Phone:
* E-mail Address:
* Service & Products Interested:
Project Description:
* Verification Code:
Please input "Profacgen" as verification code.
CONTACT US
Tel: 1-631-448-8149
Fax: 1-631-938-8127
CONTACT US
Email: info@profacgen.com
Tel: 1-631-448-8149
Fax: 1-631-938-8127
Address: 45-1 Ramsey Road, Shirley, NY 11967, USA